DEFB121 Rabbit pAb, Unconjugated

Catalog Number: ABB-A1208
Article Name: DEFB121 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1208
Supplier Catalog Number: A1208
Alternative Catalog Number: ABB-A1208-20UL,ABB-A1208-100UL,ABB-A1208-500UL,ABB-A1208-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DEFB21, ESC42RELC, DEFB121
This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 8kDa
NCBI: 245934
UniProt: Q5J5C9
Purity: Affinity purification
Sequence: MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV
Target: DEFB121
Antibody Type: Primary Antibody
Application Dilute: IF-P,1:50 - 1:100|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat
Immunofluorescence analysis of