SMARCD2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12104
Artikelname: SMARCD2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12104
Hersteller Artikelnummer: A12104
Alternativnummer: ABB-A12104-100UL,ABB-A12104-20UL,ABB-A12104-500UL,ABB-A12104-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SGD2, Rsc6p, BAF60B, CRACD2, PRO2451, SMARCD2
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 6603
UniProt: Q92925
Reinheit: Affinity purification
Sequenz: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
Target-Kategorie: SMARCD2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Chromatin Remodeling.