SMARCD2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A12104
Article Name: SMARCD2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A12104
Supplier Catalog Number: A12104
Alternative Catalog Number: ABB-A12104-100UL,ABB-A12104-20UL,ABB-A12104-500UL,ABB-A12104-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SGD2, Rsc6p, BAF60B, CRACD2, PRO2451, SMARCD2
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 6603
UniProt: Q92925
Purity: Affinity purification
Sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
Target: SMARCD2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Chromatin Remodeling.