BHMT Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A1216
- Bilder (2)
| Artikelname: | BHMT Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A1216 |
| Hersteller Artikelnummer: | A1216 |
| Alternativnummer: | ABB-A1216-100UL,ABB-A1216-20UL,ABB-A1216-500UL,ABB-A1216-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BHMT1, HEL-S-61p, BHMT |
| This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 45kDa |
| NCBI: | 635 |
| UniProt: | Q93088 |
| Reinheit: | Affinity purification |
| Sequenz: | SGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ |
| Target-Kategorie: | BHMT |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism. |


