BHMT Rabbit pAb, Unconjugated

Artikelnummer: ABB-A1216
Artikelname: BHMT Rabbit pAb, Unconjugated
Artikelnummer: ABB-A1216
Hersteller Artikelnummer: A1216
Alternativnummer: ABB-A1216-100UL,ABB-A1216-20UL,ABB-A1216-500UL,ABB-A1216-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BHMT1, HEL-S-61p, BHMT
This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 635
UniProt: Q93088
Reinheit: Affinity purification
Sequenz: SGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ
Target-Kategorie: BHMT
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism.