BHMT Rabbit pAb, Unconjugated

Product Overview

• Article Name: BHMT Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1216
• Supplier Catalog Number: A1216
• Alternative Catalog Number: ABB-A1216-100UL,ABB-A1216-20UL,ABB-A1216-500UL,ABB-A1216-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BHMT1, HEL-S-61p, BHMT

Product Description

This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 45kDa
• NCBI: 635
• UniProt: Q93088
• Purity: Affinity purification
• Sequence: SGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ
• Target: BHMT
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism.

Images