SNRPA1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12161
Artikelname: SNRPA1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12161
Hersteller Artikelnummer: A12161
Alternativnummer: ABB-A12161-20UL,ABB-A12161-100UL,ABB-A12161-500UL,ABB-A12161-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Lea1, U2A, SNRPA1
Enables RNA binding activity. Involved in mRNA splicing, via spliceosome and spermatogenesis. Located in nuclear speck. Part of U2-type catalytic step 2 spliceosome and U2-type precatalytic spliceosome. Implicated in connective tissue disease.
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 6627
UniProt: P09661
Reinheit: Affinity purification
Sequenz: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERL
Target-Kategorie: SNRPA1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Immunology Inflammation.