SNRPA1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SNRPA1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12161
• Supplier Catalog Number: A12161
• Alternative Catalog Number: ABB-A12161-20UL,ABB-A12161-100UL,ABB-A12161-500UL,ABB-A12161-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Lea1, U2A, SNRPA1

Product Description

Enables RNA binding activity. Involved in mRNA splicing, via spliceosome and spermatogenesis. Located in nuclear speck. Part of U2-type catalytic step 2 spliceosome and U2-type precatalytic spliceosome. Implicated in connective tissue disease.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 28kDa
• NCBI: 6627
• UniProt: P09661
• Purity: Affinity purification
• Sequence: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERL
• Target: SNRPA1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Immunology Inflammation.

Images