POFUT2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: POFUT2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A12223
• Hersteller Artikelnummer: A12223
• Alternativnummer: ABB-A12223-100UL,ABB-A12223-20UL,ABB-A12223-1000UL,ABB-A12223-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FUT13, C21orf80, POFUT2

Produktbeschreibung

Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF, MIM 131530)-like repeats or thrombospondin (THBS, see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 50kDa
• NCBI: 23275
• UniProt: Q9Y2G5
• Reinheit: Affinity purification
• Sequenz: MVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAII
• Target-Kategorie: POFUT2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Endocrine Metabolism.

Bilder