POFUT2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: POFUT2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12223
• Supplier Catalog Number: A12223
• Alternative Catalog Number: ABB-A12223-100UL,ABB-A12223-20UL,ABB-A12223-1000UL,ABB-A12223-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FUT13, C21orf80, POFUT2

Product Description

Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF, MIM 131530)-like repeats or thrombospondin (THBS, see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 50kDa
• NCBI: 23275
• UniProt: Q9Y2G5
• Purity: Affinity purification
• Sequence: MVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAII
• Target: POFUT2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Endocrine Metabolism.

Images