ARHGAP25 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A1223
Artikelname: ARHGAP25 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A1223
Hersteller Artikelnummer: A1223
Alternativnummer: ABB-A1223-20UL,ABB-A1223-100UL,ABB-A1223-1000UL,ABB-A1223-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KAIA0053, HEL-S-308, ARHGAP25
ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA, MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 9938
UniProt: P42331
Reinheit: Affinity purification
Sequenz: MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQL
Target-Kategorie: ARHGAP25
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction,G protein signaling,Small G proteins.