ARHGAP25 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A1223
- Bilder (2)
| Artikelname: | ARHGAP25 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A1223 |
| Hersteller Artikelnummer: | A1223 |
| Alternativnummer: | ABB-A1223-20UL,ABB-A1223-100UL,ABB-A1223-1000UL,ABB-A1223-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KAIA0053, HEL-S-308, ARHGAP25 |
| ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA, MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 73kDa |
| NCBI: | 9938 |
| UniProt: | P42331 |
| Reinheit: | Affinity purification |
| Sequenz: | MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQL |
| Target-Kategorie: | ARHGAP25 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction,G protein signaling,Small G proteins. |


