ARHGAP25 Rabbit pAb, Unconjugated

Product Overview

• Article Name: ARHGAP25 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1223
• Supplier Catalog Number: A1223
• Alternative Catalog Number: ABB-A1223-20UL,ABB-A1223-100UL,ABB-A1223-1000UL,ABB-A1223-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: KAIA0053, HEL-S-308, ARHGAP25

Product Description

ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA, MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 73kDa
• NCBI: 9938
• UniProt: P42331
• Purity: Affinity purification
• Sequence: MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQL
• Target: ARHGAP25
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction,G protein signaling,Small G proteins.

Images