Aromatase (CYP19A1) Rabbit mAb, Unconjugated

Artikelnummer: ABB-A12238
Artikelname: Aromatase (CYP19A1) Rabbit mAb, Unconjugated
Artikelnummer: ABB-A12238
Hersteller Artikelnummer: A12238
Alternativnummer: ABB-A12238-20UL,ABB-A12238-100UL,ABB-A12238-1000UL,ABB-A12238-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ARO, ARO1, CPV1, CYAR, CYP19, CYPXIX, P-450AROM, Aromatase (CYP19A1)
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity, the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0635]
Molekulargewicht: 58kDa
NCBI: 1588
UniProt: P11511
Reinheit: Affinity purification
Sequenz: MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS
Target-Kategorie: CYP19A1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IF-P,1:100 - 1:400|IHC-P,1:800 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cancer,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Endocrine Metabolism,Lipid Metabolism,Neuroscience.