Aromatase (CYP19A1) Rabbit mAb, Unconjugated

Catalog Number: ABB-A12238
Article Name: Aromatase (CYP19A1) Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A12238
Supplier Catalog Number: A12238
Alternative Catalog Number: ABB-A12238-20UL,ABB-A12238-100UL,ABB-A12238-1000UL,ABB-A12238-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ARO, ARO1, CPV1, CYAR, CYP19, CYPXIX, P-450AROM, Aromatase (CYP19A1)
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity, the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.
Clonality: Monoclonal
Clone Designation: [ARC0635]
Molecular Weight: 58kDa
NCBI: 1588
UniProt: P11511
Purity: Affinity purification
Sequence: MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS
Target: CYP19A1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IF-P,1:100 - 1:400|IHC-P,1:800 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cancer,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Endocrine Metabolism,Lipid Metabolism,Neuroscience.