beta-Tubulin Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: beta-Tubulin Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A12289
• Hersteller Artikelnummer: A12289
• Alternativnummer: ABB-A12289-100UL,ABB-A12289-200UL,ABB-A12289-20UL,ABB-A12289-50UL,ABB-A12289-1000UL,ABB-A12289-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: M40, TUBB1, TUBB5, CDCBM6, CSCSC1, OK/SW-cl.56, beta-Tubulin

Produktbeschreibung

This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0203]
• Molekulargewicht: 50 kDa
• NCBI: 203068
• UniProt: P07437
• Reinheit: Affinity purification
• Sequenz: LRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK
• Target-Kategorie: TUBB
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:3000-1:30000|IHC-P,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Cycle,Centrosome,Cytoskeleton,Microtubules.

Bilder