beta-Tubulin Rabbit mAb, Unconjugated

Product Overview

• Article Name: beta-Tubulin Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A12289
• Supplier Catalog Number: A12289
• Alternative Catalog Number: ABB-A12289-100UL,ABB-A12289-200UL,ABB-A12289-20UL,ABB-A12289-50UL,ABB-A12289-1000UL,ABB-A12289-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: M40, TUBB1, TUBB5, CDCBM6, CSCSC1, OK/SW-cl.56, beta-Tubulin

Product Description

This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC0203]
• Molecular Weight: 50 kDa
• NCBI: 203068
• UniProt: P07437
• Purity: Affinity purification
• Sequence: LRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK
• Target: TUBB
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:3000-1:30000|IHC-P,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Cycle,Centrosome,Cytoskeleton,Microtubules.

Images