GLUT2/SLC2A2 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A12307
Artikelname: GLUT2/SLC2A2 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A12307
Hersteller Artikelnummer: A12307
Alternativnummer: ABB-A12307-20UL,ABB-A12307-100UL,ABB-A12307-1000UL,ABB-A12307-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GLUT2, GLUT2/SLC2A2
This gene encodes an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. The encoded protein mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. Mutations in this gene are associated with susceptibility to diseases, including Fanconi-Bickel syndrome and noninsulin-dependent diabetes mellitus (NIDDM). Alternative splicing results in multiple transcript variants of this gene.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0305]
Molekulargewicht: 57kDa
NCBI: 6514
UniProt: P11168
Reinheit: Affinity purification
Sequenz: MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLS
Target-Kategorie: SLC2A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Lipid Metabolism,Carbohydrate metabolism,Stem Cells.