GLUT2/SLC2A2 Rabbit mAb, Unconjugated

Catalog Number: ABB-A12307
Article Name: GLUT2/SLC2A2 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A12307
Supplier Catalog Number: A12307
Alternative Catalog Number: ABB-A12307-20UL,ABB-A12307-100UL,ABB-A12307-1000UL,ABB-A12307-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GLUT2, GLUT2/SLC2A2
This gene encodes an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. The encoded protein mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. Mutations in this gene are associated with susceptibility to diseases, including Fanconi-Bickel syndrome and noninsulin-dependent diabetes mellitus (NIDDM). Alternative splicing results in multiple transcript variants of this gene.
Clonality: Monoclonal
Clone Designation: [ARC0305]
Molecular Weight: 57kDa
NCBI: 6514
UniProt: P11168
Purity: Affinity purification
Sequence: MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLS
Target: SLC2A2
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Lipid Metabolism,Carbohydrate metabolism,Stem Cells.