BST2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: BST2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A12315
• Hersteller Artikelnummer: A12315
• Alternativnummer: ABB-A12315-100UL,ABB-A12315-20UL,ABB-A12315-1000UL,ABB-A12315-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CD317, HM1.24, TETHERIN, BST2

Produktbeschreibung

Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined, however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 20kDa
• NCBI: 684
• UniProt: Q10589
• Reinheit: Affinity purification
• Sequenz: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
• Target-Kategorie: BST2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors,Cardiovascular,Blood.

Bilder