BST2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: BST2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12315
• Supplier Catalog Number: A12315
• Alternative Catalog Number: ABB-A12315-100UL,ABB-A12315-20UL,ABB-A12315-1000UL,ABB-A12315-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CD317, HM1.24, TETHERIN, BST2

Product Description

Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined, however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 20kDa
• NCBI: 684
• UniProt: Q10589
• Purity: Affinity purification
• Sequence: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
• Target: BST2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors,Cardiovascular,Blood.

Images