ENO2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ENO2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A12341
• Hersteller Artikelnummer: A12341
• Alternativnummer: ABB-A12341-100UL,ABB-A12341-20UL,ABB-A12341-1000UL,ABB-A12341-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NSE, HEL-S-279, ENO2

Produktbeschreibung

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 47kDa
• NCBI: 2026
• UniProt: P09104
• Reinheit: Affinity purification
• Sequenz: VIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL
• Target-Kategorie: ENO2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Endocrine Metabolism,Carbohydrate metabolism,Neuroscience, Cell Type Marker,Stem Cells,Neuron marker.

Bilder