ENO2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: ENO2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12341
• Supplier Catalog Number: A12341
• Alternative Catalog Number: ABB-A12341-100UL,ABB-A12341-20UL,ABB-A12341-1000UL,ABB-A12341-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IP, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NSE, HEL-S-279, ENO2

Product Description

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 47kDa
• NCBI: 2026
• UniProt: P09104
• Purity: Affinity purification
• Sequence: VIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL
• Target: ENO2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Endocrine Metabolism,Carbohydrate metabolism,Neuroscience, Cell Type Marker,Stem Cells,Neuron marker.

Images