MYBPC3 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12351
Artikelname: MYBPC3 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12351
Hersteller Artikelnummer: A12351
Alternativnummer: ABB-A12351-100UL,ABB-A12351-20UL,ABB-A12351-500UL,ABB-A12351-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FHC, CMH4, CMD1MM, LVNC10, MYBP-C, cMyBP-C, MYBPC3
MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3 is expressed exclusively in heart muscle and is a key regulator of cardiac contraction. Mutations in this gene are a frequent cause of familial hypertrophic cardiomyopathy.
Klonalität: Polyclonal
Molekulargewicht: 141kDa
NCBI: 4607
UniProt: Q14896
Reinheit: Affinity purification
Sequenz: SSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNG
Target-Kategorie: MYBPC3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Cytoskeleton,Actins,Cardiovascular,Heart,Contractility,Hypertrophy.