MYBPC3 Rabbit pAb, Unconjugated

Catalog Number: ABB-A12351
Article Name: MYBPC3 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A12351
Supplier Catalog Number: A12351
Alternative Catalog Number: ABB-A12351-100UL,ABB-A12351-20UL,ABB-A12351-500UL,ABB-A12351-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FHC, CMH4, CMD1MM, LVNC10, MYBP-C, cMyBP-C, MYBPC3
MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3 is expressed exclusively in heart muscle and is a key regulator of cardiac contraction. Mutations in this gene are a frequent cause of familial hypertrophic cardiomyopathy.
Clonality: Polyclonal
Molecular Weight: 141kDa
NCBI: 4607
UniProt: Q14896
Purity: Affinity purification
Sequence: SSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNG
Target: MYBPC3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Cytoskeleton,Actins,Cardiovascular,Heart,Contractility,Hypertrophy.