KMT2A Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12353
Artikelname: KMT2A Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12353
Hersteller Artikelnummer: A12353
Alternativnummer: ABB-A12353-500UL,ABB-A12353-20UL,ABB-A12353-100UL,ABB-A12353-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HRX, MLL, ALL1, GAS7, HTRX, MLL1, TRX1, ALL-1, CXXC7, HTRX1, MLL1A, WDSTS, KMT2A
This gene encodes a transcriptional coactivator that plays an essential role in regulating gene expression during early development and hematopoiesis. The encoded protein contains multiple conserved functional domains. One of these domains, the SET domain, is responsible for its histone H3 lysine 4 (H3K4) methyltransferase activity which mediates chromatin modifications associated with epigenetic transcriptional activation. This protein is processed by the enzyme Taspase 1 into two fragments, MLL-C and MLL-N. These fragments reassociate and further assemble into different multiprotein complexes that regulate the transcription of specific target genes, including many of the HOX genes. Multiple chromosomal translocations involving this gene are the cause of certain acute lymphoid leukemias and acute myeloid leukemias. Alternate splicing results in multiple transcript variants.
Molekulargewicht: 432kDa
NCBI: 4297
UniProt: Q03164
Reinheit: Affinity purification
Sequenz: LKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGL
Target-Kategorie: KMT2A
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Transcription Factors,Chromatin Remodeling,Cancer.