KMT2A Rabbit pAb, Unconjugated

Catalog Number: ABB-A12353
Article Name: KMT2A Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A12353
Supplier Catalog Number: A12353
Alternative Catalog Number: ABB-A12353-500UL,ABB-A12353-20UL,ABB-A12353-100UL,ABB-A12353-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HRX, MLL, ALL1, GAS7, HTRX, MLL1, TRX1, ALL-1, CXXC7, HTRX1, MLL1A, WDSTS, KMT2A
This gene encodes a transcriptional coactivator that plays an essential role in regulating gene expression during early development and hematopoiesis. The encoded protein contains multiple conserved functional domains. One of these domains, the SET domain, is responsible for its histone H3 lysine 4 (H3K4) methyltransferase activity which mediates chromatin modifications associated with epigenetic transcriptional activation. This protein is processed by the enzyme Taspase 1 into two fragments, MLL-C and MLL-N. These fragments reassociate and further assemble into different multiprotein complexes that regulate the transcription of specific target genes, including many of the HOX genes. Multiple chromosomal translocations involving this gene are the cause of certain acute lymphoid leukemias and acute myeloid leukemias. Alternate splicing results in multiple transcript variants.
Molecular Weight: 432kDa
NCBI: 4297
UniProt: Q03164
Purity: Affinity purification
Sequence: LKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGL
Target: KMT2A
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Transcription Factors,Chromatin Remodeling,Cancer.