MEF2C Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12385
Artikelname: MEF2C Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12385
Hersteller Artikelnummer: A12385
Alternativnummer: ABB-A12385-20UL,ABB-A12385-100UL,ABB-A12385-500UL,ABB-A12385-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: NEDHSIL, DEL5q14.3, C5DELq14.3, MEF2C
This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe cognitive disability, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described.
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 4208
UniProt: Q06413
Reinheit: Affinity purification
Sequenz: LPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACTSTHLSQSSNL
Target-Kategorie: MEF2C
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF-P,1:50 - 1:100|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Endocrine Metabolism,AMPK Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,Neuroscience,Calcium Signaling,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Heart,Cardiogenesis,Hypertrophy.