MEF2C Rabbit pAb, Unconjugated

Catalog Number: ABB-A12385
Article Name: MEF2C Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A12385
Supplier Catalog Number: A12385
Alternative Catalog Number: ABB-A12385-20UL,ABB-A12385-100UL,ABB-A12385-500UL,ABB-A12385-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NEDHSIL, DEL5q14.3, C5DELq14.3, MEF2C
This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe cognitive disability, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described.
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 4208
UniProt: Q06413
Purity: Affinity purification
Sequence: LPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACTSTHLSQSSNL
Target: MEF2C
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF-P,1:50 - 1:100|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Endocrine Metabolism,AMPK Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,Neuroscience,Calcium Signaling,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Heart,Cardiogenesis,Hypertrophy.