PCNA Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: PCNA Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A12427
• Hersteller Artikelnummer: A12427
• Alternativnummer: ABB-A12427-20UL,ABB-A12427-100UL,ABB-A12427-500UL,ABB-A12427-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ATLD2, PCNA

Produktbeschreibung

The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC51324]
• Molekulargewicht: 29kDa
• NCBI: 5111
• UniProt: P12004
• Reinheit: Affinity purification
• Sequenz: CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
• Target-Kategorie: PCNA
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:5000 - 1:20000|IHC-P,1:10000 - 1:40000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat,African green monkey, ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor biomarkers,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Stem Cells.

Bilder

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:15000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse esophagus tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:15000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using PCNA Rabbit mAb (A12427) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:15000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:15000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedMouse testis tissue usingPCNA Rabbit mAb(A12427) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedHuman esophageal cancer tissue usingPCNA Rabbit mAb(A12427) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedRat testis tissue usingPCNA Rabbit mAb(A12427) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedHuman esophagus tissue usingPCNA Rabbit mAb(A12427) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.