PCNA Rabbit mAb, Unconjugated

Catalog Number: ABB-A12427
Article Name: PCNA Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A12427
Supplier Catalog Number: A12427
Alternative Catalog Number: ABB-A12427-20UL,ABB-A12427-100UL,ABB-A12427-500UL,ABB-A12427-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ATLD2, PCNA
The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
Clonality: Monoclonal
Clone Designation: [ARC51324]
Molecular Weight: 29kDa
NCBI: 5111
UniProt: P12004
Purity: Affinity purification
Sequence: CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Target: PCNA
Antibody Type: Primary Antibody
Application Dilute: WB,1:5000 - 1:20000|IHC-P,1:10000 - 1:40000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat,African green monkey, ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor biomarkers,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Stem Cells.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:15000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse esophagus tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:15000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of various lysates using PCNA Rabbit mAb (A12427) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:15000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:15000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedMouse testis tissue usingPCNA Rabbit mAb(A12427) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman esophageal cancer tissue usingPCNA Rabbit mAb(A12427) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedRat testis tissue usingPCNA Rabbit mAb(A12427) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman esophagus tissue usingPCNA Rabbit mAb(A12427) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.