IGFBP5 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: IGFBP5 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A12451
• Hersteller Artikelnummer: A12451
• Alternativnummer: ABB-A12451-100UL,ABB-A12451-20UL,ABB-A12451-500UL,ABB-A12451-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IBP5, IGFBP5

Produktbeschreibung

Enables insulin-like growth factor I binding activity. Involved in several processes, including cellular response to cAMP, regulation of smooth muscle cell migration, and regulation of smooth muscle cell proliferation. Part of insulin-like growth factor ternary complex. Biomarker of pulmonary fibrosis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 31kDa
• NCBI: 3488
• UniProt: P24593
• Reinheit: Affinity purification
• Sequenz: GVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVG
• Target-Kategorie: IGFBP5
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors.

Bilder