IGFBP5 Rabbit pAb, Unconjugated

Product Overview

• Article Name: IGFBP5 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12451
• Supplier Catalog Number: A12451
• Alternative Catalog Number: ABB-A12451-100UL,ABB-A12451-20UL,ABB-A12451-500UL,ABB-A12451-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: IBP5, IGFBP5

Product Description

Enables insulin-like growth factor I binding activity. Involved in several processes, including cellular response to cAMP, regulation of smooth muscle cell migration, and regulation of smooth muscle cell proliferation. Part of insulin-like growth factor ternary complex. Biomarker of pulmonary fibrosis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 31kDa
• NCBI: 3488
• UniProt: P24593
• Purity: Affinity purification
• Sequence: GVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVG
• Target: IGFBP5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors.

Images