MYO10 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MYO10 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A12471
• Hersteller Artikelnummer: A12471
• Alternativnummer: ABB-A12471-20UL,ABB-A12471-100UL,ABB-A12471-500UL,ABB-A12471-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MyoX, MYO10

Produktbeschreibung

This gene encodes a member of the myosin superfamily. The protein represents an unconventional myosin, it should not be confused with the conventional non-muscle myosin-10 (MYH10). Unconventional myosins contain the basic domains of conventional myosins and are further distinguished from class members by their tail domains. This gene functions as an actin-based molecular motor and plays a role in integration of F-actin and microtubule cytoskeletons during meiosis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 237kDa
• NCBI: 4651
• UniProt: Q9HD67
• Reinheit: Affinity purification
• Sequenz: EAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLES
• Target-Kategorie: MYO10
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Motor Proteins.

Bilder