MYO10 Rabbit pAb, Unconjugated

Product Overview

• Article Name: MYO10 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12471
• Supplier Catalog Number: A12471
• Alternative Catalog Number: ABB-A12471-20UL,ABB-A12471-100UL,ABB-A12471-500UL,ABB-A12471-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MyoX, MYO10

Product Description

This gene encodes a member of the myosin superfamily. The protein represents an unconventional myosin, it should not be confused with the conventional non-muscle myosin-10 (MYH10). Unconventional myosins contain the basic domains of conventional myosins and are further distinguished from class members by their tail domains. This gene functions as an actin-based molecular motor and plays a role in integration of F-actin and microtubule cytoskeletons during meiosis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 237kDa
• NCBI: 4651
• UniProt: Q9HD67
• Purity: Affinity purification
• Sequence: EAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLES
• Target: MYO10
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Motor Proteins.

Images