Moesin Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Moesin Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A12473
• Hersteller Artikelnummer: A12473
• Alternativnummer: ABB-A12473-100UL,ABB-A12473-20UL,ABB-A12473-500UL,ABB-A12473-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HEL70, IMD50, Moesin

Produktbeschreibung

Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 68kDa
• NCBI: 4478
• UniProt: P26038
• Reinheit: Affinity purification
• Sequenz: KTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYK
• Target-Kategorie: MSN
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments.

Bilder