Moesin Rabbit pAb, Unconjugated

Product Overview

• Article Name: Moesin Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12473
• Supplier Catalog Number: A12473
• Alternative Catalog Number: ABB-A12473-100UL,ABB-A12473-20UL,ABB-A12473-500UL,ABB-A12473-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HEL70, IMD50, Moesin

Product Description

Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 68kDa
• NCBI: 4478
• UniProt: P26038
• Purity: Affinity purification
• Sequence: KTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYK
• Target: MSN
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments.

Images