DNA topoisomerase I (TOP1) Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12524
Artikelname: DNA topoisomerase I (TOP1) Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12524
Hersteller Artikelnummer: A12524
Alternativnummer: ABB-A12524-20UL,ABB-A12524-100UL,ABB-A12524-1000UL,ABB-A12524-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TOPI, DNA topoisomerase I (TOP1)
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22.
Klonalität: Polyclonal
Molekulargewicht: 91kDa
NCBI: 7150
UniProt: P11387
Reinheit: Affinity purification
Sequenz: MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Target-Kategorie: TOP1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer.