DNA topoisomerase I (TOP1) Rabbit pAb, Unconjugated

Product Overview

• Article Name: DNA topoisomerase I (TOP1) Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12524
• Supplier Catalog Number: A12524
• Alternative Catalog Number: ABB-A12524-20UL,ABB-A12524-100UL,ABB-A12524-1000UL,ABB-A12524-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TOPI, DNA topoisomerase I (TOP1)

Product Description

This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 91kDa
• NCBI: 7150
• UniProt: P11387
• Purity: Affinity purification
• Sequence: MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
• Target: TOP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer.

Images