TNFRSF10A Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12540
Artikelname: TNFRSF10A Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12540
Hersteller Artikelnummer: A12540
Alternativnummer: ABB-A12540-100UL,ABB-A12540-20UL,ABB-A12540-500UL,ABB-A12540-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DR4, APO2, CD261, TRAILR1, TRAILR-1, TNFRSF10A
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 8797
UniProt: O00220
Reinheit: Affinity purification
Sequenz: GGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE
Target-Kategorie: TNFRSF10A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100|IF-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Apoptosis,Death Receptor Signaling Pathway,Immunology Inflammation,CDs,Cytokines,NF-kB Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway.