TNFRSF10A Rabbit pAb, Unconjugated

Catalog Number: ABB-A12540
Article Name: TNFRSF10A Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A12540
Supplier Catalog Number: A12540
Alternative Catalog Number: ABB-A12540-100UL,ABB-A12540-20UL,ABB-A12540-500UL,ABB-A12540-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DR4, APO2, CD261, TRAILR1, TRAILR-1, TNFRSF10A
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 8797
UniProt: O00220
Purity: Affinity purification
Sequence: GGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE
Target: TNFRSF10A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100|IF-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Apoptosis,Death Receptor Signaling Pathway,Immunology Inflammation,CDs,Cytokines,NF-kB Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway.