MAD2B/MAD2L2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12559
Artikelname: MAD2B/MAD2L2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12559
Hersteller Artikelnummer: A12559
Alternativnummer: ABB-A12559-20UL,ABB-A12559-100UL,ABB-A12559-500UL,ABB-A12559-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: REV7, FANCV, MAD2B, POLZ2, MAD2B/MAD2L2
The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins.
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 10459
UniProt: Q9UI95
Reinheit: Affinity purification
Sequenz: MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Target-Kategorie: MAD2L2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle.