MAD2B/MAD2L2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A12559
Article Name: MAD2B/MAD2L2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A12559
Supplier Catalog Number: A12559
Alternative Catalog Number: ABB-A12559-20UL,ABB-A12559-100UL,ABB-A12559-500UL,ABB-A12559-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: REV7, FANCV, MAD2B, POLZ2, MAD2B/MAD2L2
The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins.
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 10459
UniProt: Q9UI95
Purity: Affinity purification
Sequence: MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Target: MAD2L2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle.