LRRC7 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: LRRC7 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A13114
• Hersteller Artikelnummer: A13114
• Alternativnummer: ABB-A13114-20UL,ABB-A13114-100UL,ABB-A13114-1000UL,ABB-A13114-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: DENSIN, LRRC7

Produktbeschreibung

Predicted to be involved in several processes, including establishment or maintenance of epithelial cell apical/basal polarity, positive regulation of neuron projection development, and receptor clustering. Located in several cellular components, including centrosome, cytosol, and nucleoplasm.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 173kDa
• NCBI: 57554
• UniProt: Q96NW7
• Reinheit: Affinity purification
• Sequenz: FPQPLDSKPLLSQREAVPPGNIPQRPDRLPMSDTFTDNWTDGSHYDNTGFVAEETTAENANSNPLLSSKSRSTSSHGRRPLIRQDRIVGVPLELEQSTHRHTPETEVPPSNPWQNWTRTPSPFEDRTAFPSKLETTPTTSPLPERKEHIKESTEIPSPFSP
• Target-Kategorie: LRRC7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker.

Bilder

Immunofluorescence analysis of C6 cells using LRRC7 Rabbit pAb (A13114) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using LRRC7 Rabbit pAb (A13114) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western blot analysis of various lysates using LRRC7 Rabbit pAb (A13114) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunofluorescence analysis of U-2 OS cells using LRRC7 Rabbit pAb (A13114) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.