LRRC7 Rabbit pAb, Unconjugated

Product Overview

• Article Name: LRRC7 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A13114
• Supplier Catalog Number: A13114
• Alternative Catalog Number: ABB-A13114-20UL,ABB-A13114-100UL,ABB-A13114-1000UL,ABB-A13114-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DENSIN, LRRC7

Product Description

Predicted to be involved in several processes, including establishment or maintenance of epithelial cell apical/basal polarity, positive regulation of neuron projection development, and receptor clustering. Located in several cellular components, including centrosome, cytosol, and nucleoplasm.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 173kDa
• NCBI: 57554
• UniProt: Q96NW7
• Purity: Affinity purification
• Sequence: FPQPLDSKPLLSQREAVPPGNIPQRPDRLPMSDTFTDNWTDGSHYDNTGFVAEETTAENANSNPLLSSKSRSTSSHGRRPLIRQDRIVGVPLELEQSTHRHTPETEVPPSNPWQNWTRTPSPFEDRTAFPSKLETTPTTSPLPERKEHIKESTEIPSPFSP
• Target: LRRC7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker.

Images