VPS25 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A13132
Artikelname: VPS25 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A13132
Hersteller Artikelnummer: A13132
Alternativnummer: ABB-A13132-100UL,ABB-A13132-20UL,ABB-A13132-500UL,ABB-A13132-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DERP9, EAP20, FAP20, VPS25
This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A pseudogene of this gene is present on chromosome 1.
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 84313
UniProt: Q9BRG1
Reinheit: Affinity purification
Sequenz: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Target-Kategorie: VPS25
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction.