VPS25 Rabbit pAb, Unconjugated

Product Overview

• Article Name: VPS25 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A13132
• Supplier Catalog Number: A13132
• Alternative Catalog Number: ABB-A13132-100UL,ABB-A13132-20UL,ABB-A13132-500UL,ABB-A13132-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DERP9, EAP20, FAP20, VPS25

Product Description

This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A pseudogene of this gene is present on chromosome 1.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 21kDa
• NCBI: 84313
• UniProt: Q9BRG1
• Purity: Affinity purification
• Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
• Target: VPS25
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction.

Images