SCGB3A2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A13137
Artikelname: SCGB3A2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A13137
Hersteller Artikelnummer: A13137
Alternativnummer: ABB-A13137-20UL,ABB-A13137-100UL,ABB-A13137-500UL,ABB-A13137-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LU103, PNSP1, UGRP1, pnSP-1, SCGB3A2
The protein encoded by this gene is a secreted lung surfactant protein and a downstream target of thyroid transcription factor. A single nucleotide polymorphism in the promoter of this gene results in susceptibility to asthma.
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 117156
UniProt: Q96PL1
Reinheit: Affinity purification
Sequenz: MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
Target-Kategorie: SCGB3A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat