SCGB3A2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SCGB3A2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A13137
• Supplier Catalog Number: A13137
• Alternative Catalog Number: ABB-A13137-20UL,ABB-A13137-100UL,ABB-A13137-500UL,ABB-A13137-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LU103, PNSP1, UGRP1, pnSP-1, SCGB3A2

Product Description

The protein encoded by this gene is a secreted lung surfactant protein and a downstream target of thyroid transcription factor. A single nucleotide polymorphism in the promoter of this gene results in susceptibility to asthma.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 10kDa
• NCBI: 117156
• UniProt: Q96PL1
• Purity: Affinity purification
• Sequence: MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
• Target: SCGB3A2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat

Images