DLST Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: DLST Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A13297
• Hersteller Artikelnummer: A13297
• Alternativnummer: ABB-A13297-1000UL,ABB-A13297-100UL,ABB-A13297-500UL,ABB-A13297-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: DLTS, KGD2, PGL7, DLST

Produktbeschreibung

This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene.

Produkteigenschaften

• Molekulargewicht: 49kDa
• NCBI: 1743
• UniProt: P36957
• Reinheit: Affinity purification
• Sequenz: PAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTT
• Target-Kategorie: DLST

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Amino acid metabolism.

Bilder