DLST Rabbit pAb, Unconjugated

Product Overview

• Article Name: DLST Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A13297
• Supplier Catalog Number: A13297
• Alternative Catalog Number: ABB-A13297-1000UL,ABB-A13297-100UL,ABB-A13297-500UL,ABB-A13297-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DLTS, KGD2, PGL7, DLST

Product Description

This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene.

Product Properties

• Molecular Weight: 49kDa
• NCBI: 1743
• UniProt: P36957
• Purity: Affinity purification
• Sequence: PAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTT
• Target: DLST

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Amino acid metabolism.

Images