UPF2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A13411
Artikelname: UPF2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A13411
Hersteller Artikelnummer: A13411
Alternativnummer: ABB-A13411-100UL,ABB-A13411-20UL,ABB-A13411-1000UL,ABB-A13411-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HUPF2, RENT2, smg-3, UPF2
This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located in the perinuclear area. It interacts with translation release factors and the proteins that are functional homologs of yeast Upf1p and Upf3p. Two splice variants have been found for this gene, both variants encode the same protein.
Klonalität: Polyclonal
Molekulargewicht: 148kDa
NCBI: 26019
UniProt: Q9HAU5
Reinheit: Affinity purification
Sequenz: GPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR
Target-Kategorie: UPF2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat, ResearchArea: Epigenetics Nuclear Signaling.
Immunohistochemistry analysis of paraffin-embedded Rat kidney using UPF2 Rabbit pAb (A13411) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug UPF2 Rabbit pAb (A13411 1:200). Western blot was performed from the immunoprecipitate using UPF2 Rabbit pAb (A7091) at a dilition of 1:1000.
Western blot analysis of various lysates, using UPF2 Rabbit pAb (A13411) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.